Protein Info for HSERO_RS01860 in Herbaspirillum seropedicae SmR1

Annotation: sulfonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 263 (169 residues), 88.8 bits, see alignment E=1.9e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to hse:Hsero_0375)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWA2 at UniProt or InterPro

Protein Sequence (273 amino acids)

>HSERO_RS01860 sulfonate ABC transporter permease (Herbaspirillum seropedicae SmR1)
MAKKNKGSFLQGLLVPIIVIALWEGASRAGWINPQILPSPWAVLRKWVEYATPLKPYDPE
AGSWLAWAFSGELVMDAIGSLYRVVAGFLIGAGLALPLGLLMGSSQRIYGLMNLTVQVIR
PIPPIAYIPLAILWFGLGNPPALFLISLGAFFPVLMNTIAGVRQVDSIYLRAARNLGASQ
STLFLRVMLPAAVPYILSGVRIGIGTAFIVVIVAEMIAVSNGLGFRIMEAREYFWSDKII
AGMITIGLLGLAIDLGMSRLNNYMLRWHRGLEN