Protein Info for HSERO_RS01600 in Herbaspirillum seropedicae SmR1

Annotation: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF03328: HpcH_HpaI" amino acids 20 to 237 (218 residues), 113 bits, see alignment E=6.7e-37

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 100% identity to hse:Hsero_0323)

Predicted SEED Role

"2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.1.2.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.- or 4.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IW51 at UniProt or InterPro

Protein Sequence (250 amino acids)

>HSERO_RS01600 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (Herbaspirillum seropedicae SmR1)
MRENRLRTLFAQQQLALSGWVSMGNALLAEVIAHSGYDAVTVDLQHGPFSIDAALPMLQA
ISSTPAVPLVRCSENSLGEINKLLDAGAYGVICPLINTAADAERFVRACHYSPRGGRSYG
PARGFLYGGADYFTHANATLLTLAMIETREGYANAEAILQTPDLDGIFIGPSDLAIELGL
APDAYDDVRLNEAIDHLLALARKLGKYVGIFAGTMEMAQRMKGIGMDLVVPGTDIQQIKA
EGARRVSALR