Protein Info for HSERO_RS01545 in Herbaspirillum seropedicae SmR1

Annotation: sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 364 to 394 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 16 to 368 (353 residues), 187.9 bits, see alignment E=3.8e-59 PF01740: STAS" amino acids 416 to 493 (78 residues), 26.1 bits, see alignment E=9.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0312)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IW40 at UniProt or InterPro

Protein Sequence (496 amino acids)

>HSERO_RS01545 sulfate transporter (Herbaspirillum seropedicae SmR1)
LPMTTITTPTSRLRDLRQNVLAGLTTSFALVPECIAFALVAQLNPLMGLYGAFFICTITA
LFGGRPGMISGAAGSMAVVIVALVVQHGAQYFLATVVLSGLIMLAFGALRLGKLVRMVPH
PVMLGFVNGLAIVIALSQLEHFRIATAAGTQWLQGSALWVMIALTLATMLIVWLLPRVTK
AVPPALAAILGVGLVTYASGLHTRTLADMAQIAGGLPPLHLPSVPLTLETLRIIGPYAVL
MAIVGLLETLLTFNLTDEITATRGQPNRECLALGAANIVSGLFGGMGGCAMIGQTMINLG
SGGRSRLSGVVAGVMILLFILFLSPAIERIPLAALAGVMFVVAQETFAWGSLRVLGKVPR
SDALVIIAVTVITVLTDLAVAVLCGIVIAALNFAWQHAREVRSDVRDEDDGSRTYLPHGT
LFFASTTHFLALFDTGNDPQEVTLDCRHLRLADHSAIAAVQTLAERYTRMGKQLRVVALS
QRCSQLLQRAGLPQVA