Protein Info for HSERO_RS01530 in Herbaspirillum seropedicae SmR1

Annotation: 3',5'-cyclic-nucleotide phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00753: Lactamase_B" amino acids 21 to 69 (49 residues), 25.7 bits, see alignment 1.6e-09 PF12706: Lactamase_B_2" amino acids 28 to 216 (189 residues), 69.4 bits, see alignment E=5.2e-23 PF02112: PDEase_II" amino acids 44 to 217 (174 residues), 45 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: K01120, 3',5'-cyclic-nucleotide phosphodiesterase [EC: 3.1.4.17] (inferred from 100% identity to hse:Hsero_0309)

Predicted SEED Role

"CAMP phosphodiesterases class-II:Metallo-beta-lactamase superfamily" in subsystem cAMP signaling in bacteria

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.17

Use Curated BLAST to search for 3.1.4.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IW37 at UniProt or InterPro

Protein Sequence (257 amino acids)

>HSERO_RS01530 3',5'-cyclic-nucleotide phosphodiesterase (Herbaspirillum seropedicae SmR1)
MHVEILGCSGGIGGNGMRTTSLLIDDDILIDAGTGVGDLTLERLQAIDHVFITHAHLDHI
ACLPLMIDSVGDMRPTPITMHATAATLEIIRKHIFNWHIWPDFSVIPSAEQPFLRFATIE
PGQTVALGQRSITALPAAHTVPAVGYQVKNERSGASLAFSGDTTVCPPLWQALNRIVQLR
YLIIEAAFANRERELALLSKHLCPALLLEELQHLQSRPEVLVTHAKPSQVQEIAAEIAAG
GTAHRPRMLEAGTILEL