Protein Info for HSERO_RS01255 in Herbaspirillum seropedicae SmR1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 521 to 539 (19 residues), see Phobius details PF12418: AcylCoA_DH_N" amino acids 3 to 34 (32 residues), 49.3 bits, see alignment (E = 9.7e-17) PF02771: Acyl-CoA_dh_N" amino acids 82 to 160 (79 residues), 42.5 bits, see alignment E=2e-14 PF02770: Acyl-CoA_dh_M" amino acids 165 to 273 (109 residues), 41.8 bits, see alignment E=2.5e-14 PF00441: Acyl-CoA_dh_1" amino acids 285 to 452 (168 residues), 69.1 bits, see alignment E=1.3e-22 PF12806: Acyl-CoA_dh_C" amino acids 470 to 592 (123 residues), 111.9 bits, see alignment E=5.6e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0254)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVY2 at UniProt or InterPro

Protein Sequence (596 amino acids)

>HSERO_RS01255 acyl-CoA dehydrogenase (Herbaspirillum seropedicae SmR1)
MPQYNAPLRDMQFVLHELLNVEEVFKELPPHADTNRELVDQVLEEGGKFASQVLFPLNHS
GDREGCHYDRESKTVTTPKGFKQAYQQYVEAGWAALSCDPEFGGQGLPLTINNSFYEMLN
SSNQAWTMYPGLSHGAYECLHAHGSEEQKQLYLPKLVSGEWTGTMCLTEAHCGTDLGLLR
SKAEPQADGSYKITGNKIFISAGENDVSANIIHLVLARLPDAPEGSKGISLFLVPKFLPN
ADGSLGARNPIFCGAIEEKMGIHGNATCQMNLDGATGWLIGQPHKGLQAMFVFMNAARLG
VGMQGLGLTEVAYQNALVYAKDRLQMRSLSGIKAADKPADPIIVHPDVRRMLLTAKAFAE
GGRAFTSYVALELDKELTHPDEQVRKDSADIVALLTPVVKAFLTDNAWMATSECLQVYGG
HGYIAEWGMEQYVRDARINMIYEGTNTIQSLDLLGRKILMDNGAKLKKFGAQIQAFVEEH
GTDESMSEFITPLADIGDKVTKLTMEIGMKSFANQDEAGAAAVPYLRVVGHLVFSYLFAR
MAKIALEKQDSGDSFYAAKLATARFYFARLLPETAMLIRQARSGAANLMALDAELF