Protein Info for HSERO_RS01200 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 73 to 101 (29 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 91.7 bits, see alignment E=1.7e-30 PF00528: BPD_transp_1" amino acids 35 to 209 (175 residues), 61.7 bits, see alignment E=4e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0243)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV50 at UniProt or InterPro

Protein Sequence (227 amino acids)

>HSERO_RS01200 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MHYEFDFASVAAHWPLLLQGAWTTVQLSFLATLLGFVLGAACAVARGSRHGWLRAAVSGY
VELIRNTPLLIQCYFLIFGLSSVGVTMPIMAGATLALVINIGAYSCEIVRAGLESIHHGQ
LEAASCLGLSPAQVFWHVVLLPAVERVWPALTSQFVLMMLASSILSSVGAEELLGVANRV
QSDTFRNFEVFLLLWAAYLALACLMRAGFWLLGQLVFTRRRKLGTPL