Protein Info for HSERO_RS01070 in Herbaspirillum seropedicae SmR1

Annotation: bacteriophage protein gp18 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 transmembrane" amino acids 422 to 432 (11 residues), see Phobius details amino acids 449 to 472 (24 residues), see Phobius details amino acids 557 to 586 (30 residues), see Phobius details PF10145: PhageMin_Tail" amino acids 118 to 331 (214 residues), 60.4 bits, see alignment E=1.1e-20 TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 288 to 463 (176 residues), 35 bits, see alignment E=4.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0217)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV24 at UniProt or InterPro

Protein Sequence (779 amino acids)

>HSERO_RS01070 bacteriophage protein gp18 protein (Herbaspirillum seropedicae SmR1)
MTQAPDLDLAGLRLSLADLVFEAQKSTRALEQIGAQLSRMTAGLPKAAAPLRSVRWQAQG
AALSEQGLHQMEQARATAQQLHGVLNAAAAYEDLIKDIAISANLTREKEVDLAKSVRQAA
VSMNVDHQKVAGMMQSLVDGGMSADRAKTLLPVLAKTAHATRRDTTVISGLATTFDTLGV
KKMELAFNQVAKASKLGGVSMDEMAASLPKLGGYLGDLGVKGEQAVVNLGARLQVSARTA
GNGKEAADNLEHFLSKLSGADSVRAFSKRGVDLLGKLRGASVAGQDPVATGIDLFMNQLQ
RNSSKAGDQLNKLALEMGQITDPVQRQQLLQRHQALFAQLGKETGLKDLFGDMQAVSYLL
AELSSKNQLPGMINDISSGKDADGRLVIDAMGQRRGEGMTDQLNAFKVTTHDLKIALGNA
LIPAMQALLPIVTQLVRGLTGFIDAHPKLAATIGTLVVGATALSFAGGAIKVVRGTALGL
AGRMSASDDEAPPSRMGRRAARGRRIKFGGPLPKLGAPTVKPGGIIGKGLRGMLSGVGRL
AGVAARGLRLLGSAGRVAFGLLSVGARGFGMALTANPIGMVIRLVFKLAEVIWRNWRPIS
RFAGTLFNGLMAGIRRVKNFLDPFLKIGGQIIDGLVGGIRQGWTKVVETISKLGSAIRDK
FKSLLGISSPSRVFMGFGANIGEGAQQGIQSKLGAVRQASGQMAGVAKASAVLAGSTPAP
TGHRASAAGAGMVLHFSPTVHVAGASGARGAVEQAMRLSMQELEQLLRRLQGEQQRRAF