Protein Info for HSERO_RS00950 in Herbaspirillum seropedicae SmR1

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR01048: diaminopimelate decarboxylase" amino acids 7 to 426 (420 residues), 511.2 bits, see alignment E=8.1e-158 PF00278: Orn_DAP_Arg_deC" amino acids 30 to 384 (355 residues), 94.9 bits, see alignment E=4.4e-31 PF02784: Orn_Arg_deC_N" amino acids 61 to 295 (235 residues), 216.8 bits, see alignment E=4.9e-68 PF01168: Ala_racemase_N" amino acids 92 to 242 (151 residues), 27.2 bits, see alignment E=4.7e-10

Best Hits

Swiss-Prot: 60% identical to DCDA_PSEFL: Diaminopimelate decarboxylase (lysA) from Pseudomonas fluorescens

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to hse:Hsero_0191)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUZ8 at UniProt or InterPro

Protein Sequence (430 amino acids)

>HSERO_RS00950 diaminopimelate decarboxylase (Herbaspirillum seropedicae SmR1)
MSHFSYRNGVLHAEQVSLATLAEQFGTPLYVYSKAALVENFSAYANACQQAGRADGGKGG
ALVCYSVKSNSNLAVLNLLGRLGSGFDIVSGGELLRVVAAGGDARKVIFSGVGKGRDEMK
LALEHDILCFNVESIPEVARLNEVAGALGKRARISLRVNPNVDAKTHPYISTGLKENKFG
VAYEDALNCYRAAAALPHIEVVGIDCHIGSQLLDDSPLLEALDKIIDMVDALEAEGIPIH
HLDIGGGIGIRYDDEQPVAIGDYLARVFARVDAWRASKYQGRPIQVMFEPGRSVVGNAGL
LLTEVQYLKHGEGKNFAVVDAAMNDLMRPAMYEAWHGVKTVKENAGQPRIYDVVGPVCES
GDWLARSRELAIGEGDLLALMSAGAYGMTMASNYNTRGRAAEVLVDGERAHLIRARENPA
DLFALEKIVS