Protein Info for HSERO_RS00885 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): L-proline ABC transporter, permease component 1
Rationale: No data for this gene, but fitness data for surrounding genes implies this is part of a proline transporter
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 293 (286 residues), 158.6 bits, see alignment E=9.1e-51

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_0177)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUY4 at UniProt or InterPro

Protein Sequence (309 amino acids)

>HSERO_RS00885 L-proline ABC transporter, permease component 1 (Herbaspirillum seropedicae SmR1)
MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV
APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAM
MIWGRSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRAT
AENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAV
LGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGI
MGERVADRA