Protein Info for HSERO_RS00855 in Herbaspirillum seropedicae SmR1

Annotation: alkylhydroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02627: CMD" amino acids 50 to 102 (53 residues), 43.8 bits, see alignment E=1e-15 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 58 to 100 (43 residues), 44.2 bits, see alignment E=5.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0171)

Predicted SEED Role

"Macrophage infectivity potentiator-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUX8 at UniProt or InterPro

Protein Sequence (177 amino acids)

>HSERO_RS00855 alkylhydroperoxidase (Herbaspirillum seropedicae SmR1)
MSRLTIAPLSEASGQAAQLFAAIKSAVGMVPNAYAGIGTLSPVALESALHLDGALRKSSL
SAKEIEAVKLAVSQQAGCDYCLAAHTLMGRKAGLDAQAIQGVRHGQPSGDDRLDVLADFV
RGLVGSSGTVAASVVERVRAVYSDAQIVDILLAVTAITFTNLFNRVNDTVLDFPPAP