Protein Info for HSERO_RS00555 in Herbaspirillum seropedicae SmR1

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 TIGR00484: translation elongation factor G" amino acids 1 to 699 (699 residues), 1203.8 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 207.1 bits, see alignment E=4.6e-65 TIGR00231: small GTP-binding protein domain" amino acids 9 to 187 (179 residues), 108.4 bits, see alignment E=3.3e-35 PF03144: GTP_EFTU_D2" amino acids 329 to 396 (68 residues), 69.9 bits, see alignment E=5e-23 PF14492: EFG_III" amino acids 409 to 483 (75 residues), 117.5 bits, see alignment E=5.6e-38 PF03764: EFG_IV" amino acids 484 to 603 (120 residues), 166 bits, see alignment E=7.3e-53 PF00679: EFG_C" amino acids 607 to 693 (87 residues), 107.4 bits, see alignment E=7.7e-35

Best Hits

Swiss-Prot: 82% identical to EFG1_BORA1: Elongation factor G 1 (fusA1) from Bordetella avium (strain 197N)

KEGG orthology group: K02355, elongation factor G (inferred from 82% identity to bav:BAV0022)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITZ6 at UniProt or InterPro

Protein Sequence (701 amino acids)

>HSERO_RS00555 elongation factor G (Herbaspirillum seropedicae SmR1)
MARKTPIERYRNIGISAHIDAGKTTTTERVLFYTGVNHKIGEVHDGAATMDWMEQEQERG
ITITSAATTCYWKGMANNFPAHHINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQ
PQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYEQMRARLKANPIPMQVPIGAEENFE
GVIDLVKMRAIYWDDASQGMKFDYRDIPEHLKADAQKWRENLVETAAEASEDLMNKYLEE
GDLTEAEIKGAIRQRTISGEIVPMMCGTAFKNKGVQAMLDGVVEYLPSPVDIPPVPGLNE
DDEPVVREAKDDEKFSALAFKIATDPFVGQLCFIRCYSGTLNSGDTVLNSVKSKKERIGR
IVQMHANQREEIKEMMAGDIAAVVGLKDTTTGDTLCDDKAMVVLERMVFPEPVISQAVEP
KTKADQEKMGLALNRLAAEDPSFRVRTDEESGQTIIAGMGELHLDIIVDRMKREFNVEAT
VGKPQVAYRETIRKTCEESEGKFVKQSGGRGQYGHVVLKIEPQEAGKGFEFVDAIKGGTV
PREFIPAVEKGVRETLNTGVLAGYPVVDVKVTLFFGSYHDVDSNENAFRMAGSMAFKEGC
RRASPVILEPMMAVEVETPEDYAGTVMGDLSSRRGMVQGMDEIAGGGGKIIKAEVPLSEM
FGYSTTLRSATQGRATYSMEFKHYSEAPKNVIDAIVTSKAK