Protein Info for HSERO_RS00460 in Herbaspirillum seropedicae SmR1

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF13489: Methyltransf_23" amino acids 8 to 172 (165 residues), 51.6 bits, see alignment E=2.7e-17 PF07021: MetW" amino acids 10 to 197 (188 residues), 224.5 bits, see alignment E=2.9e-70 TIGR02081: methionine biosynthesis protein MetW" amino acids 10 to 197 (188 residues), 235.3 bits, see alignment E=2.2e-74 PF13847: Methyltransf_31" amino acids 22 to 113 (92 residues), 37.7 bits, see alignment E=5.4e-13 PF13649: Methyltransf_25" amino acids 26 to 110 (85 residues), 44.7 bits, see alignment E=5.5e-15 PF08241: Methyltransf_11" amino acids 27 to 112 (86 residues), 53 bits, see alignment E=1.3e-17 PF08242: Methyltransf_12" amino acids 27 to 110 (84 residues), 33.7 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0092)

Predicted SEED Role

"Methionine biosynthesis protein MetW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITY1 at UniProt or InterPro

Protein Sequence (200 amino acids)

>HSERO_RS00460 methionine biosynthesis protein MetW (Herbaspirillum seropedicae SmR1)
MTFEQLSALRPDLAFIAHWVREKSQVLDLGCGDGVMLDYLQSDKGCTGYGVEIDDAQIPK
CVARNVSVIQQDLNGGLAMFEDNAFDTVLCLSALQMVKDVEGTLREIARVGREVTVSFPN
FAYWPHRVALLRGRMPVSRSLPYQWYDTPNLRCATIRDFEALANELGLEVLECVALKDGK
PVRYLPNWRGSLAVFRLRKK