Protein Info for HSERO_RS00315 in Herbaspirillum seropedicae SmR1

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 64 to 244 (181 residues), 85 bits, see alignment E=2.8e-28

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_0064)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITV3 at UniProt or InterPro

Protein Sequence (250 amino acids)

>HSERO_RS00315 amino acid ABC transporter permease (Herbaspirillum seropedicae SmR1)
MNSFFQWEIIGEYLPLFVEGTWMTLKAAIICVIAGTCWGLVLGVGRLAEARHGFWKYFLC
YCVQWPIRFYVSFLRGTPLFVQILLIHFALMPMLINPSGGLILSGDLAREIRSHYGAFAS
AVLAITLNSGAYVSEIFRAGIQSIDRGQSEASRSLGMSYLATLRRVVLPQAFRRMLPPLG
NNAIAIVKDSSLASAIGLAELAYAARTVSGAYARYWEPYLTISVIYWLITLALSALVRHL
EARYGKGDAR