Protein Info for HMPREF1078_RS17710 in Parabacteroides merdae CL09T00C40

Annotation: fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05681: Fumerase
  • amino acids 51 to 326 (276 residues), 265.5 bits, E=5e-83
• TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type
  • amino acids 73 to 325 (253 residues), 108.2 bits, E=4.3e-35
• PF05683: Fumerase_C
  • amino acids 332 to 537 (206 residues), 287.4 bits, E=5e-90
• TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  • amino acids 373 to 537 (165 residues), 206.7 bits, E=2.4e-65

Best Hits

Swiss-Prot: 76% identical to FUMB_ECOLI: Fumarate hydratase class I, anaerobic (fumB) from Escherichia coli (strain K12)

KEGG orthology group: K01676, fumarate hydratase, class I [EC: 4.2.1.2] (inferred from 93% identity to bfr:BF0676)

MetaCyc: 76% identical to fumarase B (Escherichia coli K-12 substr. MG1655)
D(-)-tartrate dehydratase. [EC: 4.2.1.81]; Fumarate hydratase. [EC: 4.2.1.81, 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class I, anaerobic (EC 4.2.1.2)" in subsystem Serine-glyoxylate cycle (EC 4.2.1.2)

MetaCyc Pathways

• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• partial TCA cycle (obligate autotrophs) (5/8 steps found)
• TCA cycle I (prokaryotic) (6/10 steps found)
• TCA cycle III (animals) (6/10 steps found)
• TCA cycle VIII (Chlamydia) (3/6 steps found)
• TCA cycle II (plants and fungi) (5/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (17/26 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• reductive TCA cycle II (6/12 steps found)
• superpathway of glyoxylate bypass and TCA (6/12 steps found)
• L-glutamate degradation VIII (to propanoate) (5/11 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)
• methylaspartate cycle (10/19 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (6/14 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.2 or 4.2.1.81

Protein Sequence (546 amino acids)

>HMPREF1078_RS17710 fumarate hydratase (Parabacteroides merdae CL09T00C40)
MATTPFKYQAPFPLGPDTTEYYLLTKDYVSVSEFEGTPVLKVEKEGLTAMANAAFRDVSF
MLRRSHNEQVAKILSDPEASDNDKYVALTFLRNAEVAAKGVLPFCQDTGTAIIHGEKGQQ
VWTGYCDEEALSLGVYKTYTEENLRYSQNAPLNMYDEVNTKCNLPAQIDIEATEGMEYKF
LCVTKGGGSANKTYLYQETKAILNPGTLVPFIIEKIKTLGTAACPPYHIAVVIGGTSAEK
NLLTVKLASTHYYDELPTTGNEYGRAFRDIELEKEVLAEVHNIGLGAQFGGKYLAHDIRI
IRLPRHGASCPVGLGVSCSADRNVKCKINKDGIWIEKLDSHPGELIPAELREAGEGDAVK
INLNQPMTEILKELDKYPVATRLSLNGTIIVGRDIAHAKLKERLDRGEDLPQYIKDHPIY
YAGPAKTPTGMACGSMGPTTAGRMDPYVGLFQSHGGSMIMLAKGNRSQQVTDACQKYGGF
YLGSIGGPAAILAQNNIKSIECVEYPELGMEAIWKIEVEDFPAFILVDNKGNDFFKQIKP
RCTCSK