Protein Info for HMPREF1078_RS17695 in Parabacteroides merdae CL09T00C40

Annotation: adenosylcobinamide-phosphate synthase CbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 58 to 76 (19 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 300 to 316 (17 residues), see Phobius details PF03186: CobD_Cbib" amino acids 18 to 296 (279 residues), 333.3 bits, see alignment E=6e-104 TIGR00380: cobalamin biosynthesis protein CobD" amino acids 21 to 271 (251 residues), 223.3 bits, see alignment E=2.2e-70

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 76% identity to pdi:BDI_3959)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>HMPREF1078_RS17695 adenosylcobinamide-phosphate synthase CbiB (Parabacteroides merdae CL09T00C40)
MYYWFHQSFYMAKAFPFIGGWLADRLLGDPEGWPHPVVGFGKVISLGEKTLNKGNDRAVK
GGVMALILVAGTYLLCERILALAGYFHPIVASILSGIGVFYCLAGKTLVKEVKAVFEAVD
RSTEEGRKQVGRIVGRDTSRLSPQEIRAAALETLAENLSDGVIAPMFWFALLGLPGMMTY
KMVNTLDSMIGYKNERYLEFGQIAARLDDLANYIPARLTAWLMLAVSGNLNKTDFVKRFG
PAHASPNSGYPESALAAILNCRFGGTHDYFGKPVEKPYIGTNERTFTTEDMLIAIKTNSN
AELAMGLIVCLISIIIH