Protein Info for HMPREF1078_RS17570 in Parabacteroides merdae CL09T00C40

Annotation: XRE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF13443: HTH_26" amino acids 10 to 68 (59 residues), 25.5 bits, see alignment E=1.9e-09 PF01381: HTH_3" amino acids 11 to 63 (53 residues), 29.3 bits, see alignment E=1.1e-10 PF07883: Cupin_2" amino acids 131 to 188 (58 residues), 53.9 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: None (inferred from 84% identity to pdi:BDI_2771)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>HMPREF1078_RS17570 XRE family transcriptional regulator (Parabacteroides merdae CL09T00C40)
MGNNKIIGAKIKSIRESKQLSTQEVSERSGLSIEQIERIEGNIDFPSLAPLIKIARVLGV
RLGTFLDDQSELGPVICRKKDSNDTNSIGFSNNDSKARKHMEYHSLSQDKSGRHMEPFLI
DVAPSEEGVDFVLSTHEGEEFIYVLEGILEINYGKNTYILEEGDSIYYDSIVAHHVHAAA
DNTAKILGVIYTPY