Protein Info for HMPREF1078_RS17495 in Parabacteroides merdae CL09T00C40

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF01041: DegT_DnrJ_EryC1" amino acids 14 to 356 (343 residues), 357.9 bits, see alignment E=3.4e-111

Best Hits

Swiss-Prot: 56% identical to FDTB_ANETH: dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (fdtB) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 64% identity to lil:LA_1655)

MetaCyc: 56% identical to dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (Aneurinibacillus thermoaerophilus L420-91)
RXN-12811 [EC: 2.6.1.90]

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1 or 2.6.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>HMPREF1078_RS17495 DegT/DnrJ/EryC1/StrS family aminotransferase (Parabacteroides merdae CL09T00C40)
MIEYENLGRTNKSLEKEYKECFSSFLESGWYVLGKEVRTFEESFAGYCGVKHCIGVASGL
DALMLALRIYDFPQGSEVLVPSNTYIATILSILQCGLKPVLVEPDIRTYNIDPLKIEEHI
SEKTKAIMVVHLYGKACEMTSIMQLAGKYNLQLIEDCAQAHGAKYKGQKVGTFGTGAFSF
YPTKNLGALGDAGAITTNDSKADSVFRALRNYGSNIKYQNDYIGYNSRLDEIQAALLNVK
LKHLDEINAHKRKLAQIYIEGLKEDFIKPIVTSDCFDVYHIFNVRHPKRDMLKEYLLKNE
VKTDIHYPIPPHRQKAMQGILKGEYPISEEIHRTTLSLPISYGHSESDVYRVVEIMNKF