Protein Info for HMPREF1078_RS17400 in Parabacteroides merdae CL09T00C40

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 138 to 171 (34 residues), see Phobius details PF02417: Chromate_transp" amino acids 3 to 166 (164 residues), 173.6 bits, see alignment E=1.9e-55

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 83% identity to pdi:BDI_3350)

Predicted SEED Role

"Chromate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>HMPREF1078_RS17400 chromate transporter (Parabacteroides merdae CL09T00C40)
MYWTLFLTFVKIGTFTIGGGYAMLPLIQREVVDKGWLSKEDFIDLFSVAQSLPGIFAVNI
SIFVGYKLKKVPGGIVCALGSILPSFFIILAIALFFTHVQDNIWVEKAFKGLRPAVVALI
AVPCLTTARSIKMSYKELIIPIAAALLIWQGGLSPVWIILAAIIGGLVYGLKIKKD