Protein Info for HMPREF1078_RS17210 in Parabacteroides merdae CL09T00C40

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 184 to 217 (34 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 24 to 327 (304 residues), 132.6 bits, see alignment E=2.2e-42 PF00005: ABC_tran" amino acids 394 to 543 (150 residues), 109 bits, see alignment E=3e-35

Best Hits

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 86% identity to pdi:BDI_2424)

Predicted SEED Role

"ABC transporter, ATP-binding protein, MsbA family"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (615 amino acids)

>HMPREF1078_RS17210 ABC transporter ATP-binding protein (Parabacteroides merdae CL09T00C40)
MKDFLRILRRFVPPYKKFMVWNVIFNVLSAILNLFSFALIIPILNILFKISDETYTYTDW
TFAPFSFEAWKATPELLKNNFFWFVSDMIETKGGSFTLIILGVFLIVSTFLKVGTMYMAF
YTMIPIRTGVVRDIRNQINRKITELPLGFFSEERKGDIIARVSGDVNEIETSIMSSLDML
FKNPILILIYLIGMIAISWQLTLFVFILLPFAGYVMGTVGKKLKRKSFEGQQQWGYLMSQ
IEETLGGLRVIKAFNAEAKIQDRFEKSNETFRRLTNRIYRRQQMAHPMSEFLGTATIAIV
LWYGGTLILSSNSPIDASTFIYYLVIFYSIINPAKDLSKASYAIQKGLASMDRVDKILKA
ESNINDPEDPKPIALTESICYRDVWFKYQHEWVLKGIDLTIPKGHTVALVGQSGSGKSTL
VDLLPRFYDVDKGSITIDGTDVRDATLYDLRSLMGNVNQEAILFNDTFFNNISFGVEGAT
LEQVQEAARIANAHDFIMASEDGYDTNIGDRGGKLSGGQRQRISIARAILKNPPILILDE
ATSALDTESERLVQEALENLMRNRTTIVIAHRLSTIRNADEICVMHEGEIVERGRHEELI
ALDGYYKRLCDMQSF