Protein Info for HMPREF1078_RS17185 in Parabacteroides merdae CL09T00C40

Annotation: phosphate ABC transporter ATP-binding protein PstB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 4 to 250 (247 residues), 396.4 bits, see alignment E=2.3e-123 PF00005: ABC_tran" amino acids 19 to 175 (157 residues), 115 bits, see alignment E=4.4e-37 PF13304: AAA_21" amino acids 116 to 204 (89 residues), 27 bits, see alignment E=4.2e-10

Best Hits

Swiss-Prot: 80% identical to PSTB_BACTN: Phosphate import ATP-binding protein PstB (pstB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 90% identity to pdi:BDI_2420)

MetaCyc: 57% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>HMPREF1078_RS17185 phosphate ABC transporter ATP-binding protein PstB (Parabacteroides merdae CL09T00C40)
MIKIDAQNVDFHYGDFHALKNISMQIEANTSVAFIGPSGCGKSTFLRLFNRMNDLIPDTR
LEGKIFIDGRDIYSKGEKVDTLRKNVGMVFQKPNPFPKTIFENVAYGLRVNGIKDNGYIE
ETVVKSLKQVVLWDEVKDKLKDSAFALSGGQQQRLCIARALAISPSILLMDEPTSALDPI
STGKIEDLIHELKKEYTIVIVTHNMQQAARVSDKTGYFYLGELVEYGETRKIFTNPEKES
TQNYITGRFG