Protein Info for HMPREF1078_RS17175 in Parabacteroides merdae CL09T00C40

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 170 to 200 (31 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details PF12849: PBP_like_2" amino acids 35 to 97 (63 residues), 33.2 bits, see alignment E=4.8e-12 TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 151 to 394 (244 residues), 294.3 bits, see alignment E=4.3e-92 PF00528: BPD_transp_1" amino acids 194 to 393 (200 residues), 74 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 86% identity to pdi:BDI_2418)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>HMPREF1078_RS17175 phosphate ABC transporter permease subunit PstC (Parabacteroides merdae CL09T00C40)
MRKFFEKIVEGGLLISGSVSSFTILLIVFFLFKEAGGLFNTPATEEGYVLAVNKSNDVGK
LSPEKIMDIFDGNITNWKDISGMDQDILIFRFSDLTNYYTEEELGDEFQYVPQKISELVA
KEPGIIAFFPKQYLLEKGFQGKVLPEEKITLGEFFGGTKWYPTSTPAPIFGLIPLLLGTL
LVSIGAIVLSLPFGIAVAIYMAEIANKRTRDLLKPIIELLAGIPSVVYGFFGLVVIVPLI
QKTFDLPVGETAFAGSVVLAIMALPTIITVAEDAMRTTPRAMKEASLALGATQWQTIYKV
IIPYSISGITSAVVLGIGRAIGETMAVLMVTGNAAVIPTSFFEPVRTIPATIAAELGEAP
AGGAHYEALFLLGAVLFLITLILSISVEYISSKRKI