Protein Info for HMPREF1078_RS17155 in Parabacteroides merdae CL09T00C40

Annotation: gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 15 to 18 (4 residues), see Phobius details transmembrane" amino acids 19 to 30 (12 residues), see Phobius details PF00106: adh_short" amino acids 9 to 202 (194 residues), 200.1 bits, see alignment E=4e-63 PF08659: KR" amino acids 11 to 163 (153 residues), 48.6 bits, see alignment E=1.4e-16 PF13561: adh_short_C2" amino acids 15 to 255 (241 residues), 218.4 bits, see alignment E=1.7e-68

Best Hits

Swiss-Prot: 39% identical to FABG_THEMA: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 95% identity to bsa:Bacsa_2429)

MetaCyc: 84% identical to 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase monomer (Streptococcus agalactiae NEM316)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127 or 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>HMPREF1078_RS17155 gluconate 5-dehydrogenase (Parabacteroides merdae CL09T00C40)
MVNFSLEGKVALVTGASYGIGFAIATAFAKAGATIVFNDIKQELVDKGLAAYEAEGIKAH
GYVCDVTNEEQVNAFVAQVEKEVGVIDILVNNAGIIKRIPMVEMTAAEFRQVIDIDLNGP
FIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNIASEYGEYNI
QCNGIGPGYIATPQTAPLRERQADGSRHPFDAFIVAKTPAARWGTPEDLMGPAVFLASDA
SNFVNGHVLYVDGGILAYIGKQP