Protein Info for HMPREF1078_RS17075 in Parabacteroides merdae CL09T00C40

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details PF02405: MlaE" amino acids 33 to 244 (212 residues), 215.7 bits, see alignment E=3e-68

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 92% identity to pdi:BDI_2401)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>HMPREF1078_RS17075 ABC transporter permease (Parabacteroides merdae CL09T00C40)
MNKALHQVGEYVMLMGKCISVPNRWSMFFKQLIKEIYKLGVDSLWIVVIISIFIGTVIAI
QISLNISSPLIPKFTIGYTTREIILLEFSSSIMSLILAGKVGSNIASEIGTMRVTEQIDA
MEIMGVNSANFLILPKMVGMMTFIPVLVIFSMFTGILGGIAASHSTGTGMTPASFEYGLQ
FYFNEFYIWYSIIKSVVYAFIISSIAAYFGYNVKGGALEVGKASTNAVVMSSIMILLADV
ILTNLMLT