Protein Info for HMPREF1078_RS17005 in Parabacteroides merdae CL09T00C40

Annotation: DNA mismatch repair endonuclease MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 TIGR00585: DNA mismatch repair protein MutL" amino acids 5 to 306 (302 residues), 295.4 bits, see alignment E=3.6e-92 PF02518: HATPase_c" amino acids 23 to 83 (61 residues), 37.4 bits, see alignment 6e-13 PF13589: HATPase_c_3" amino acids 26 to 120 (95 residues), 44.1 bits, see alignment E=4.4e-15 PF01119: DNA_mis_repair" amino acids 210 to 326 (117 residues), 115.8 bits, see alignment E=1.8e-37 PF08676: MutL_C" amino acids 441 to 578 (138 residues), 91.3 bits, see alignment E=1e-29

Best Hits

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>HMPREF1078_RS17005 DNA mismatch repair endonuclease MutL (Parabacteroides merdae CL09T00C40)
MSDIIHLLPDSIANQIAAGEVIQRPASVVKELVENAVDAGAGHIQVNIKDAGRTLVQVID
DGKGMSETDARMAFERHATSKISTADDLFSLHTMGFRGEALASIVAVSQVELRTRLKGAE
LGTHLVFSGSELESVEPDACTEGSIFSVKNLFFNVPARRKFLKSNETEFRNIINEFERIA
LVNSQVALSLYHNDTEIFNLPESGLRQRIVNVYGKTLNQKLLSVDAQSSLVTISGFVGRP
DSAKKRGALQYFFVNGRFMKHPYFHKAVMQAYEQLIPAGEQPNYFIYFTLDPATIDVNIH
PTKTEIKFENEQPIWQILMAATREALAKSSAIPTIDFDVEDAIDIPVYNPVKEAAPYKAP
CVQVNSGYNPFETSSYKKPEFDWSKLYNDFEGDRNAIRQGAELTGSFLAPDLSEPAIEAD
EVVVQDTSGSLFNDVSNPCYQYKGKYIITSLKSGLALIDQHRAHVRILFDQYITNIRQQR
GASQQVLFPEIVEFTAGEATVLPTLLEDMRFIGFDLTNLGNNSYAINGLPAGVENLDPVS
LIRNMVDRVIDTGCEVHEEICDSLALSLAKAAAIRPGKILSGEEMDNLLASLFSCQESNL
TPDGKTIISKLTDEELEKRFK