Protein Info for HMPREF1078_RS16970 in Parabacteroides merdae CL09T00C40
Annotation: 50S ribosomal protein L23
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to RL23_CHLT3: 50S ribosomal protein L23 (rplW) from Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
KEGG orthology group: K02892, large subunit ribosomal protein L23 (inferred from 94% identity to pdi:BDI_2378)MetaCyc: 41% identical to 50S ribosomal subunit protein L23 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L23p (L23Ae)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (97 amino acids)
>HMPREF1078_RS16970 50S ribosomal protein L23 (Parabacteroides merdae CL09T00C40) MGIIIKPIVTEKQTAITEKMDNRYGFRVSPDANKLEIKKAIEDMYNVTVVDVNTINYSGK KKSRYTKSGIINGKQSAFKKAIVTLKEGETIDFFSNI