Protein Info for HMPREF1078_RS16785 in Parabacteroides merdae CL09T00C40

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00510: lipoyl synthase
  • amino acids 3 to 279 (277 residues), 358.8 bits, E=1.2e-111
• PF04055: Radical_SAM
  • amino acids 58 to 217 (160 residues), 56.9 bits, E=1.5e-19

Best Hits

Swiss-Prot: 89% identical to LIPA_PARD8: Lipoyl synthase (lipA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 89% identity to pdi:BDI_2192)

MetaCyc: 51% identical to lipoyl synthase (lipoic acid synthetase) (Bacillus subtilis subtilis 168)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (281 amino acids)

>HMPREF1078_RS16785 lipoyl synthase (Parabacteroides merdae CL09T00C40)
MSEHLRKPDWLKIRLGGNEQFTRTKSIVESHCLHTICTSGKCPNMGECWSRGTATFMIAG
DICTRSCRFCNTLTGKPLPLDPKEPANVAESIRLMNLKHAVITSVDRDDLPDLGAQHWVD
TIRTIKAVNPETTVEVLIPDFQGRLELVDKVVAAAPEIISHNMETVRRISPEVRSAAKYE
VSLSVLARIAAQGVVAKTGIMVGLGETVEEVCELMDDVRAAGVSVLTIGQYLQPSRKNIP
VKEYVTPEQFESYKSIALQKGFKKVESAPLVRSSYHAEKHV