Protein Info for HMPREF1078_RS16645 in Parabacteroides merdae CL09T00C40

Annotation: methylglyoxal synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to MGSA_TRESO: Methylglyoxal synthase (mgsA) from Treponema socranskii

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 93% identity to pdi:BDI_2060)

MetaCyc: 37% identical to methylglyoxal synthase (Escherichia coli K-12 substr. MG1655)
Methylglyoxal synthase. [EC: 4.2.3.3]

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.3

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>HMPREF1078_RS16645 methylglyoxal synthase (Parabacteroides merdae CL09T00C40)
MKKLTIALVAHDNRKADMVEWAIHNAEFLSHHHIVCTGTTGNLVRKAMEEKGVTADIACM
HSGPLGGDAEIAAMVVRKEIDLAVFLIDDLNPQPHEADIQMLLRQCRVHNVPIACNRYSA
DLMITSTLWDDESYVPTEPKYVYFKRE