Protein Info for HMPREF1078_RS16640 in Parabacteroides merdae CL09T00C40

Annotation: 3-isopropylmalate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00169: 3-isopropylmalate dehydrogenase" amino acids 4 to 344 (341 residues), 423.1 bits, see alignment E=4.2e-131 PF00180: Iso_dh" amino acids 4 to 343 (340 residues), 395.1 bits, see alignment E=1.7e-122

Best Hits

Swiss-Prot: 92% identical to LEU3_BACFN: 3-isopropylmalate dehydrogenase (leuB) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 95% identity to pdi:BDI_2059)

MetaCyc: 50% identical to 3-isopropylmalate dehydrogenase (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydrogenase. [EC: 1.1.1.85]

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>HMPREF1078_RS16640 3-isopropylmalate dehydrogenase (Parabacteroides merdae CL09T00C40)
MKLNIAVLPGDGIGPEIAAQGVEVMSAVCKKFGHEVRYEYALCGADAIDKVGDPFPEETY
EICKGADAVLFSAVGDPKFDNDPTAKVRPEQGLLAMRKKLGLFANIRPVQTFKCLLHKSP
LRADLVDGADFLCIRELTGGMYFGEKYQDNDKAYDTNMYTRPEIERILKVGFEYAMKRKK
HLTVVDKANVLASSRLWRQIAQEMAPSYPEVQTDYMYVDNAAMRMIQEPKFFDVMVTENT
FGDILTDEGSCISGSMGLLPSASTGESTPVFEPIHGSWPQAKGLNIANPLAQILSVAMLF
EYFGCKAEGALIRKAVDASLDANVRTPEIQMEGGAKYGTKEVGTWIVNYINN