Protein Info for HMPREF1078_RS16630 in Parabacteroides merdae CL09T00C40

Annotation: mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 77 to 107 (31 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 8 to 42 (35 residues), 23.1 bits, see alignment 8.3e-09 PF00924: MS_channel_2nd" amino acids 95 to 160 (66 residues), 75.2 bits, see alignment E=5.3e-25 PF21082: MS_channel_3rd" amino acids 166 to 248 (83 residues), 57.2 bits, see alignment E=2.8e-19

Best Hits

Swiss-Prot: 42% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 80% identity to pdi:BDI_2057)

MetaCyc: 38% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>HMPREF1078_RS16630 mechanosensitive ion channel (Parabacteroides merdae CL09T00C40)
MTQGAALGWTLIKAFLVFIVGRLLINLVNKLIKRVLLKRDIDPSVKTFVGSLVNVVLTIL
LIISVVGALGVQTTSFAALLASAGVAVGMALSGNLANFAGGLIILLFKPFKVGDYIEAQG
TGGTVKEIQIFHTILATPDNKMVYIPNGSLSSGAVTNFSRQTTRRVDWTFGVDYGEDYDK
VKAVIETIIARDSRILTDPAPFIALHALADSSVNIVVRVWVESPNYWEVYFGINQAVYAT
FNEKGINFPFPQLTVHRADN