Protein Info for HMPREF1078_RS16205 in Parabacteroides merdae CL09T00C40

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 4 to 176 (173 residues), 140.3 bits, E=2.8e-45
• TIGR00152: dephospho-CoA kinase
  • amino acids 4 to 179 (176 residues), 108.8 bits, E=1.5e-35

Best Hits

Swiss-Prot: 50% identical to COAE_BACTN: Dephospho-CoA kinase (coaE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 70% identity to pdi:BDI_1861)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Protein Sequence (209 amino acids)

>HMPREF1078_RS16205 dephospho-CoA kinase (Parabacteroides merdae CL09T00C40)
MIKIGITGGIGSGKSMVAALLEVWGIPVYIADTESKHLTATSPVIREKLITLFGKELYTA
DGLDKRRLASHIFGNPERLGQVNAIIHPEVNRHFFAWVERLNTPVCAIESAILFESGFNR
IVDTTLMVYAPMEIRIGRILERDSVSREEIIRRIESQLPDEMKKEKSDYVIFNDGEQALL
PQITAFLAGLKIKNIDSQFYNKHKNKNIQ