Protein Info for HMPREF1078_RS16035 in Parabacteroides merdae CL09T00C40

Annotation: UDP-N-acetyl-D-mannosamine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 388 (388 residues), 371.3 bits, see alignment E=2.8e-115 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 178 (178 residues), 185.2 bits, see alignment E=1.5e-58 PF00984: UDPG_MGDP_dh" amino acids 195 to 282 (88 residues), 94.2 bits, see alignment E=6.5e-31 PF03720: UDPG_MGDP_dh_C" amino acids 310 to 400 (91 residues), 47.5 bits, see alignment E=3.1e-16

Best Hits

Swiss-Prot: 51% identical to EPSD_RALSO: NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase (epsD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02472, UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase [EC: 1.1.1.-] (inferred from 77% identity to bfs:BF0743)

Predicted SEED Role

"UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>HMPREF1078_RS16035 UDP-N-acetyl-D-mannosamine dehydrogenase (Parabacteroides merdae CL09T00C40)
MKACFMGLGYIGLPTAIITAGSGIQVIGVDVNPKVVEMTNRGIIHIVEPGLQELCSKVME
FGKLKASDVPEESDVYLIVVPTPFKGNHEPDISYVEAATRMVAPFLKKGDLFVIESTSPV
GTTEKMANLLYALRPELEGKIYIAYCPERVLPGNVIYELMQNDRVIGGINSESTEKAIQF
YRHFVRGTLHRTNARTAEMCKLTENSSRDVQIAFANELSLICDKAGINVWELIELANKHP
RVNILQPGSGVGGHCIAVDPYFLTSEFPYESQLISKAREINNYKAFWCAEKIENAILRFF
LEHHRKPVVALMGLSFKPDIDDLRESPAKYITSKVLQRSADTDILIVEPNVHEHPVFKLT
DYKSAYTRADIGAFLVSHKEFKTLPHNEEKVILDFCGVFKKL