Protein Info for HMPREF1078_RS15905 in Parabacteroides merdae CL09T00C40

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 42 to 282 (241 residues), 173.9 bits, E=1.7e-54
• PF05175: MTS
  • amino acids 135 to 219 (85 residues), 27.7 bits, E=6e-10
• PF03602: Cons_hypoth95
  • amino acids 136 to 217 (82 residues), 24.3 bits, E=6.6e-09
• PF13847: Methyltransf_31
  • amino acids 148 to 237 (90 residues), 36.8 bits, E=9.4e-13
• PF13649: Methyltransf_25
  • amino acids 151 to 221 (71 residues), 35.1 bits, E=5.3e-12
• PF08241: Methyltransf_11
  • amino acids 151 to 219 (69 residues), 25.6 bits, E=4.6e-09

Best Hits

Swiss-Prot: 56% identical to PRMA_BACFN: Ribosomal protein L11 methyltransferase (prmA) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 79% identity to pdi:BDI_0289)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (283 amino acids)

>HMPREF1078_RS15905 50S ribosomal protein L11 methyltransferase (Parabacteroides merdae CL09T00C40)
MNYYELTFTYTSPVETSIINDVLAAELGEIGFESFAENENGLQGYISDQLYNVKGLQDKL
AEFPLENVDIHFTETLVESKDWNEEWEKNYFKPIRIGKDCIIRASFHEHEPGYAYNIIID
PKMAFGTGNHETTFLMISEILKLDLTSKELLDMGCGTAVLAILAHMKGAGRVVAIDIDEW
AYNNALENIRLNNTNDIQVALGGAEQIPAFGTFDIVFANINRNILLNDIRHYSECMKPGA
FLYMSGFYVQDIPAIEEECKHNGLALLSHTEKNNWAAVKVQKQ