Protein Info for HMPREF1078_RS15470 in Parabacteroides merdae CL09T00C40

Annotation: adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 4 to 140 (137 residues), 30.2 bits, E=9.1e-11
• PF00406: ADK
  • amino acids 6 to 162 (157 residues), 181.9 bits, E=1.3e-57
• PF13207: AAA_17
  • amino acids 7 to 143 (137 residues), 123.3 bits, E=1.3e-39

Best Hits

Swiss-Prot: 93% identical to KAD_PARD8: Adenylate kinase (adk) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 93% identity to pdi:BDI_1898)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (20/26 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (4/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• purine deoxyribonucleosides salvage (2/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (189 amino acids)

>HMPREF1078_RS15470 adenylate kinase (Parabacteroides merdae CL09T00C40)
MLNIVIFGAPGSGKGTQSELIIKEYGLDHISTGDVLRSEMKNETELGKIAKDYIEKGQLV
PDELIVDMLAKVLDSKVNSKGVIFDGFPRTIPQAKALKEMLNKRGTDVSVMLNLQVEEEE
LINRLLERGKVSGRSDDNLETIKSRLDVYHKQTAPLADYYIGEGKHVAIKGMGTIEEIFG
RIKDAVNNL