Protein Info for HMPREF1078_RS15445 in Parabacteroides merdae CL09T00C40

Annotation: electron transport complex subunit RsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 3 to 435 (433 residues), 577.2 bits, see alignment E=8.8e-178 PF13375: RnfC_N" amino acids 8 to 102 (95 residues), 103.8 bits, see alignment E=2.5e-33 PF05896: NQRA" amino acids 20 to 203 (184 residues), 35.2 bits, see alignment E=5.7e-12 PF01512: Complex1_51K" amino acids 130 to 276 (147 residues), 164.3 bits, see alignment E=1.1e-51 PF10531: SLBB" amino acids 288 to 335 (48 residues), 44.7 bits, see alignment 5.3e-15 PF13237: Fer4_10" amino acids 365 to 418 (54 residues), 28.4 bits, see alignment 7.5e-10 PF13183: Fer4_8" amino acids 365 to 420 (56 residues), 27.9 bits, see alignment 1.6e-09 PF13187: Fer4_9" amino acids 368 to 420 (53 residues), 32 bits, see alignment 5.7e-11

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 91% identity to pdi:BDI_0515)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>HMPREF1078_RS15445 electron transport complex subunit RsxC (Parabacteroides merdae CL09T00C40)
MLRTFRIGGIHPPENKLSAGKKITALAAPKQVIIPLSQHIGAPAQAVVKKGDLVKVGTLV
AKAGGFVSANIHSSVSGKVNKIDNALDSSGYKRPAIYIDVEGDEWEETIDRSDALVKDCT
LSSKEIVDKIAAAGIVGLGGATFPTQVKLMPPPGSKAEIIIINAVECEPYLTSDHSLMME
KGEQILVGVTLLMKAVNVNKAVIGIENNKPDAIAHLTKLAAAYPGIEIMPLKVQYPQGGE
KQLIDAVIRRQVKSGALPISAGAVVQNVGTAYAVYEAVQKNKPLFERVVTVTGKAVANPS
NFLVRMGTPINTLIEAAGGIPENTGKIIGGGPMMGKALVSAEVPVTKGSSGVLLLTKEES
VRKPMQDCIRCAKCVNVCPMGLNPAFLMKFTIYKDWEKAEGGYIQDCIECGSCSYTCPAH
RPLLDQIRLGKGKVMGIIRARKS