Protein Info for HMPREF1078_RS15400 in Parabacteroides merdae CL09T00C40

Annotation: 3-phosphoserine/phosphohydroxythreonine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01364: phosphoserine transaminase
  • amino acids 4 to 355 (352 residues), 454.2 bits, E=1.4e-140
• PF00266: Aminotran_5
  • amino acids 5 to 344 (340 residues), 125.9 bits, E=1e-40

Best Hits

Swiss-Prot: 94% identical to SERC_PARD8: Phosphoserine aminotransferase (serC) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 94% identity to pdi:BDI_0505)

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Protein Sequence (355 amino acids)

>HMPREF1078_RS15400 3-phosphoserine/phosphohydroxythreonine transaminase (Parabacteroides merdae CL09T00C40)
MKKHNFYAGPSILSEYTIKNTAAAVENFAGMGLSLLEISHRSKEFVAVNDEARALIKELL
DVPAGYEVVFLGGGASMQFCMVPYNLLNKKASYLDTGTWSSKAIKEAKLFGEVEVVASSK
DKNYTYIPKDYTIADDADYFHITTNNTIYGTETRKDPDVKQRLVADMSSDIFSRPIDVSK
YDIIYAGAQKNLAPAGVTLAIVRVDALGHVERPIPTMLNYKTHVDKDSMFNTPPVLPIYA
ALQTLKWYKEQGGVAAMEKKDMENAAILYDEIDRNKLFRGTVAAEDRSIMNVCFVMNDEY
KELEDEFSKFAAAAGMVGIKGHRSVGGFRASLYNAMPKSSVEALVACMKDFEKQH