Protein Info for HMPREF1078_RS15325 in Parabacteroides merdae CL09T00C40

Annotation: bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 TIGR00197: YjeF family N-terminal domain" amino acids 4 to 213 (210 residues), 114.2 bits, see alignment E=6.4e-37 PF03853: YjeF_N" amino acids 27 to 192 (166 residues), 140.5 bits, see alignment E=5.4e-45 TIGR00196: YjeF family C-terminal domain" amino acids 231 to 500 (270 residues), 218 bits, see alignment E=1.6e-68 PF01256: Carb_kinase" amino acids 253 to 494 (242 residues), 201.7 bits, see alignment E=1.3e-63

Best Hits

KEGG orthology group: None (inferred from 77% identity to pdi:BDI_1900)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>HMPREF1078_RS15325 bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase (Parabacteroides merdae CL09T00C40)
MIKIFSTDKVRELDKYTIQNEPISSIDLVERAATVFTSEFCRRYSKQTRIIVFAGQGNNG
ADALAIARMLTDAGYRVETYLFNPTMRLSDDCELNKQRLLHMEKIEFTEVVDDFVPPELE
ERDVVIDGLFGSGLNRPLTGGFAAMVRYINQSNATVVAIDIPSGLFGEDNRKNDPDAIIH
ADLTLTFGFPKLAFLLPENAEFVGEWKVLDILLHPEIIASTPTQFTLVTEEDIAAVFQPR
NRFAYKGTFGHALLIAGSHGKMGAALLSAKACLRSGAGLLTVHIPGRGEQILQTAFPEAM
VDLDQHQDHFSSVSGIKAYSSIAIGPGLGQHPDSVKALEQLLQVVEKPLVIDADALNLIA
ANKDLLKRIPPRSILTPHPKEFDRIAGESTNSYERLKKAQAFATDHQLCVVLKGAYTAIC
TATGNVYFNNCGNPGMATAGSGDVLTGIILALLAQGLEPETAAVSGVFLHGTAGDLAAVY
RSEESMIASDITDMLGKAFKQIK