Protein Info for HMPREF1078_RS15280 in Parabacteroides merdae CL09T00C40

Annotation: malonyl-ACP O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 12 to 253 (242 residues), 219.4 bits, see alignment E=3.3e-69 PF13489: Methyltransf_23" amino acids 26 to 184 (159 residues), 47.6 bits, see alignment E=3.9e-16 PF13847: Methyltransf_31" amino acids 47 to 151 (105 residues), 30.5 bits, see alignment E=7.3e-11 PF13649: Methyltransf_25" amino acids 50 to 140 (91 residues), 44.1 bits, see alignment E=6.9e-15 PF08242: Methyltransf_12" amino acids 50 to 142 (93 residues), 36.1 bits, see alignment E=2.3e-12 PF08241: Methyltransf_11" amino acids 50 to 144 (95 residues), 52.7 bits, see alignment E=1.3e-17

Best Hits

Swiss-Prot: 47% identical to BIOC_PORGI: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 59% identity to pdi:BDI_1917)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>HMPREF1078_RS15280 malonyl-ACP O-methyltransferase BioC (Parabacteroides merdae CL09T00C40)
MEAIETKQIHIRFTRALSSYDNHADAQHRISRKLASLLPHQANVRYKRMLEIGCGTGGFT
EVLKQQCHIDEWILNDLCEDCQEKIEQLFPGSPPRFIAGDAETLSFPGKFDLIASASVFQ
WMKEPETFLHKLSGLLMQQGLLLFSTFVPGNLYEIKELTGKGLVYPTSDTLVGWLSTADF
NLLHQEEDTIVLTFKTPLDVLRHLKATGVTATGNGCWTKGRQESFCRQYAEQFATTDGQV
TLTYRPLYILATKK