Protein Info for HMPREF1078_RS15270 in Parabacteroides merdae CL09T00C40

Annotation: RIP metalloprotease RseP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 375 to 402 (28 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 7 to 442 (436 residues), 218 bits, see alignment E=1e-68 PF02163: Peptidase_M50" amino acids 11 to 429 (419 residues), 170 bits, see alignment E=9.8e-54 PF17820: PDZ_6" amino acids 234 to 278 (45 residues), 34.2 bits, see alignment 3.6e-12

Best Hits

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 80% identity to pdi:BDI_0481)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>HMPREF1078_RS15270 RIP metalloprotease RseP (Parabacteroides merdae CL09T00C40)
METFLVKALQLILSLSILVLVHEFGHFIFARIFKVRVEKFYLFFDPWFSIFKFKPKNSDT
EYGVGWLPLGGYCKISGMIDESMDKEAMAQPPKPYEFRSKPAGQRLMIMVAGVLFNFLLA
LFIYSMVLFTWGDTFLPLKNVKAGMDYSETFHNVGFQDGDILLKADDTELERFGEDCFRR
VLNAQTVTVLRGGVETVIPIPEDMAQRVMRDKKGFASYRFPMVVRELGKTESGESPAAVA
GLQPGDSIVSINGIVTPSFYEVGEVLAQNKDKDVLVGFYRAGIPQTLTLHTDTAGKMGIY
SVSPFDMYQTVTRKYGFFESFPAGVMLGVNTLKGYVSDMKYVFTKEGASSLGGFGTIGSL
FPAEWDWHSFWMKTAFLSIILAFMNILPIPALDGGHVMFLLYEVIARRKPSDKFLEYAQV
TGMFLLFALLIYANGNDIFRFFFK