Protein Info for HMPREF1078_RS14950 in Parabacteroides merdae CL09T00C40

Annotation: SsrA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00086: SsrA-binding protein
  • amino acids 10 to 152 (143 residues), 189 bits, E=2.1e-60
• PF01668: SmpB
  • amino acids 11 to 152 (142 residues), 187.7 bits, E=5.2e-60

Best Hits

Swiss-Prot: 94% identical to SSRP_PARD8: SsrA-binding protein (smpB) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03664, SsrA-binding protein (inferred from 94% identity to pdi:BDI_0413)

Predicted SEED Role

"tmRNA-binding protein SmpB" in subsystem Heat shock dnaK gene cluster extended or Staphylococcal pathogenicity islands SaPI or Trans-translation by stalled ribosomes

Protein Sequence (153 amino acids)

>HMPREF1078_RS14950 SsrA-binding protein (Parabacteroides merdae CL09T00C40)
MKEKISNNIQIKNKRATFDYELLDTFTAGIVLTGTEIKSIRLGKASLVDTFCIVEKGELW
VKNMYVAEYFYGTYNNHTARRDRKLLLTKKELRKIESAARNNGFTIIPTRLFINDKGLAK
VVVAIAKGKKEYDKRDSIKERDDRREMDRAFKR