Protein Info for HMPREF1078_RS14680 in Parabacteroides merdae CL09T00C40

Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 277 (277 residues), 314.7 bits, see alignment E=2.2e-98 PF02569: Pantoate_ligase" amino acids 2 to 277 (276 residues), 349.1 bits, see alignment E=7e-109

Best Hits

Swiss-Prot: 88% identical to PANC_PARD8: Pantothenate synthetase (panC) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 88% identity to pdi:BDI_0213)

MetaCyc: 46% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>HMPREF1078_RS14680 pantoate--beta-alanine ligase (Parabacteroides merdae CL09T00C40)
MKIVNSIKELKSYLAEEKRNNKQIGFVPTMGALHDGHLSLVERCVKENDVCVVSVFVNPT
QFNDKHDLETYPRTLDKDCTLLEPVGCDYVFAPSAEEMYPEPDTRTFDFGTVSAVMEGAR
RPGHFNGVAQIVSKLFYVVEPDNAYFGEKDFQQIAVIRAMVKQLDIPVKINDCPILREAD
GLALSSRNVRLTPEQRQKAPLIARTLKESTNFVPEKSVQEVIDYVVNTINADPIMRVEYY
EIVDGNTMESIKNWSDTTYPVGCITVYCGEVRLIDNIKY