Protein Info for HMPREF1078_RS14660 in Parabacteroides merdae CL09T00C40

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08323: Glyco_transf_5
  • amino acids 2 to 205 (204 residues), 46.8 bits, E=9.9e-16
• PF13579: Glyco_trans_4_4
  • amino acids 129 to 218 (90 residues), 45.7 bits, E=2.9e-15
• PF13439: Glyco_transf_4
  • amino acids 132 to 225 (94 residues), 49.8 bits, E=1.2e-16
• PF20706: GT4-conflict
  • amino acids 178 to 364 (187 residues), 58.7 bits, E=1.6e-19
• PF00534: Glycos_transf_1
  • amino acids 239 to 393 (155 residues), 119.7 bits, E=2.9e-38
• PF13692: Glyco_trans_1_4
  • amino acids 244 to 381 (138 residues), 96.6 bits, E=4.8e-31

Best Hits

KEGG orthology group: None (inferred from 93% identity to bvu:BVU_2775)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (422 amino acids)

>HMPREF1078_RS14660 glycosyltransferase (Parabacteroides merdae CL09T00C40)
MKVLMFGWEFPPKIYGGLAVASYGITKGLSLQNDVETTFCLPKPTGEEEGFLNIIGMNQV
PVVWRDVNYDYLKSRLPNYMTPEQYYAFRDHIYADFSYLNVNDLGCMEFAGGYPANLHDE
INNFSIIAGVVARQQQFDIIHAHDWLTYPAGVHAKMVSGKPLCIHVHATDFDRSRGKVNP
TVYATEKNGMDYADCIMCVSELTRQTVIREYHQDPRKCFAMHNAVYPLSQELLDIPRPEH
KKEKVVTFLGRITMQKGPEYFVEAAALVLKRTRNIRFIMAGSGDMLDAMINLAAERGIAD
RFHFPGFQRGRQVYEAYKNSDVFVMPSVSEPFGIAPLEAMQCGTPSIISKQSGCGEILDK
VIKTDYWDIHAMADAIYSICTNPSLFEYLQVEGKKEVDGITWEKVGLRIRALYENVLKNY
GK