Protein Info for HMPREF1078_RS14645 in Parabacteroides merdae CL09T00C40

Annotation: dCMP deaminase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF00383: dCMP_cyt_deam_1" amino acids 11 to 118 (108 residues), 87.8 bits, see alignment E=4.1e-29 PF14437: MafB19-deam" amino acids 13 to 121 (109 residues), 71.1 bits, see alignment E=8.9e-24

Best Hits

KEGG orthology group: K01493, dCMP deaminase [EC: 3.5.4.12] (inferred from 87% identity to pdi:BDI_0206)

Predicted SEED Role

"dCMP deaminase (EC 3.5.4.12)" (EC 3.5.4.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>HMPREF1078_RS14645 dCMP deaminase family protein (Parabacteroides merdae CL09T00C40)
MCDKKEKQLELDKRYLRMAAVWAENSYCKRRQVGALIVKDQMIISDGYNGTPSGFENVCE
DEHNVTKPYVLHAEANAITKVAASSNSSKGATIYVTSAPCIECAKLIIQSGIKRVVYSEK
YRVEDGCNLLRRAGVIIDYIEIND