Protein Info for HMPREF1078_RS14640 in Parabacteroides merdae CL09T00C40

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 56 to 358 (303 residues), 287 bits, see alignment E=9.1e-90 PF00595: PDZ" amino acids 102 to 171 (70 residues), 25.9 bits, see alignment E=1.6e-09 PF13180: PDZ_2" amino acids 103 to 178 (76 residues), 47.4 bits, see alignment E=3.1e-16 PF03572: Peptidase_S41" amino acids 204 to 358 (155 residues), 174.8 bits, see alignment E=1.7e-55

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 78% identity to pdi:BDI_0205)

Predicted SEED Role

"Carboxy-terminal processing protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>HMPREF1078_RS14640 S41 family peptidase (Parabacteroides merdae CL09T00C40)
MDKNKRLAVWLPVIIALSIALGIFVGNHYLRLTQGKRHIYSSGNKINAILDIIDEQYVDT
VDMKQLVEDAIPKVFSELDPHSVYIPAKDAQRANEDLEGSFSGIGVSFNMQTDTILVINV
IPGGPSEKAGLKPFDRIITINDSLYAGNKSDQEVIMKTLRGAKNSTVKLGIKRKNEPELL
YFDVTRGDVPVSSVDVSYEVSKGIGYIKVSKFGRTTYNEFITAIAKLKQAGCTSFVIDLR
GNTGGYMDAAINMVNEFMPEGRLIVYTEGKAFPRNDVYTNGTGTCQDAPIVVLTDEFSAS
ASEIFSGAIQDNDRGLIIGRRTFGKGLVQSPIQLSDGSEIRLTIARYYTPSGRCIQKKYE
LGKDSEYEQDIYQRFMHGEFDSADSIKLNNSEKYETVMGRPVYGGGGIMPDIFIPRDTSG
VTSYFSNVVNSGMLNLYALEYSDRNYDKLASFKTYQDLHKYLQQQPLLSDFTNYAAAKGI
KKRPHLINISGKLIEKQIQAYIVRNFFDEAGFYPIFQNDDITLKRAVKVLNEGKSFPTLE
NKNNTPNGIAQSQTNTSRGYGFLKEIIYEDYIAGSLC