Protein Info for HMPREF1078_RS14335 in Parabacteroides merdae CL09T00C40

Annotation: glycine betaine/L-proline ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 35 to 388 (354 residues), 431.1 bits, see alignment E=1.8e-133 PF00005: ABC_tran" amino acids 44 to 191 (148 residues), 123.1 bits, see alignment E=2.8e-39 PF00571: CBS" amino acids 276 to 330 (55 residues), 25.3 bits, see alignment 3.1e-09 amino acids 337 to 388 (52 residues), 32.9 bits, see alignment 1.4e-11

Best Hits

Swiss-Prot: 50% identical to OPUAA_BACSU: Glycine betaine transport ATP-binding protein OpuAA (opuAA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 81% identity to pdi:BDI_0096)

Predicted SEED Role

"Glycine betaine ABC transport system, ATP-binding protein OpuAA (EC 3.6.3.32)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.6.3.32)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>HMPREF1078_RS14335 glycine betaine/L-proline ABC transporter ATP-binding protein (Parabacteroides merdae CL09T00C40)
MTKIEIKDLSILFGPEKAKAKKMIKQGKSKQEILKETGCTIAVRNANLEIKEGEMFVIMG
LSGSGKSTLVRCINRLNEPSMGEIWLSGRNITSLSDKELLQIRRKEMAMVFQHFGLLPHR
TVLSNIAFGLELQGVPKEEREKKAYESIAVVGLKGYENQRVDELSGGMQQRVGLARALAN
DPEVLLMDEAFSALDPLIREQMQDELLDLQEKMKRTIVFITHDLDEAIKLGDRIAIMKDG
EVVQVGTPEEILTDPANDYVTRFTESVDRGRVVTASSIMLTQPIVVRIRKDGPEAIIRKM
REKRLYALPVIGTDEQFLGEIRLKDVLRLRKEGARDISSIVMKEVPSVLESMTVEDMLPL
LPKVHQALPVVDENNRLKGVVSTSAIIIEMTGKDQKEIEEIIQNAIDL