Protein Info for HMPREF1078_RS14285 in Parabacteroides merdae CL09T00C40

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 11 to 489 (479 residues), 356.2 bits, E=2.8e-110
• PF01070: FMN_dh
  • amino acids 268 to 384 (117 residues), 25.6 bits, E=9.6e-10

Best Hits

Swiss-Prot: 68% identical to IMDH_TRIFO: Inosine-5'-monophosphate dehydrogenase (IMPDH) from Tritrichomonas foetus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 90% identity to pdi:BDI_0090)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (20/26 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• purine nucleotides degradation I (plants) (8/12 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (5/8 steps found)
• ureide biosynthesis (3/7 steps found)
• superpathway of purines degradation in plants (8/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (497 amino acids)

>HMPREF1078_RS14285 IMP dehydrogenase (Parabacteroides merdae CL09T00C40)
MAVYLNDVSRTFGEYLLIPGLTTKQCVPTNVSLKTPLVKHKVGEKPAIELNIPFVSAIMQ
SVSGPKLAIELARNGGLSFIFGSQPIDSQAEMVRKVKKFKAGFVISDSNLTPENTLADVI
ALVQRTEHSTIGVTDDGTPNGKLLGMVTSRDYRAEKDSPDKKVKEFMTPFSKLIVGELGM
TLSEANQIIWDHKLNTLPIIDKEQNLQYFVFRKDYDSHRDNPKELSGSDKKLLVGAGINT
RDYMERVPALVEAGVDVLCIDSSDGYSEWQQATLQWIKKNYGDKVLVGAGNVVDKEGFDY
LVEAGADFIKVGIGGGSICITREQKGIGRGQATALIDVAQARDEYMKKTGIYVPICSDGG
LVHDYHMVLALAMGADFLMMGRYFARFDESPTKKMKIGNNFVKEYWGEGSNRAKNWQRYD
MGGSEALKFEEGVDSYVPYAGKMKDNLNLTLGKIIATMCSCGAITIPDLQKNAKITLVSS
TSIVEGGAHDVILKEQN