Protein Info for HMPREF1078_RS14210 in Parabacteroides merdae CL09T00C40

Annotation: phosphoribosylaminoimidazolesuccinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF01259: SAICAR_synt" amino acids 18 to 260 (243 residues), 241 bits, see alignment E=7.5e-76

Best Hits

Swiss-Prot: 88% identical to PUR7_BACTN: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 90% identity to pdi:BDI_1987)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>HMPREF1078_RS14210 phosphoribosylaminoimidazolesuccinocarboxamide synthase (Parabacteroides merdae CL09T00C40)
MKKALTKTDFNFPGQKSVYHGKVRDVYNINDDVLVMVATDRISAFDVVLPEGIPYKGQML
NQIAAKFLDATTDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCGSAWRAYKSGVRE
ICGVKLPEGMRENERFPEPIVTPTTKAEIGEHDADISKEEILAKGLATPEEYELLEKYTL
ALFKRGTEIAAERGLILVDTKYEFGKHGGKIYLMDEIHTPDSSRYFYSEGYEERFAKGEP
QKQLSKEFVREWLMENDFQGKAGQKVPEMTPAIVDGISERYIELYEHITGEKFEKGDTDN
LLSRIEKNVTEYLNK