Protein Info for HMPREF1078_RS14075 in Parabacteroides merdae CL09T00C40

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF05693: Glycogen_syn" amino acids 13 to 349 (337 residues), 190.8 bits, see alignment E=9.4e-60 amino acids 366 to 547 (182 residues), 113.9 bits, see alignment E=1.8e-36 PF00534: Glycos_transf_1" amino acids 429 to 475 (47 residues), 31.8 bits, see alignment 2e-11

Best Hits

KEGG orthology group: None (inferred from 81% identity to pdi:BDI_2004)

Predicted SEED Role

"Glycogen"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>HMPREF1078_RS14075 glycosyltransferase (Parabacteroides merdae CL09T00C40)
MDNTTTTPEYLFESSWEVCNKVGGIYTVLSTKAHTLQRSFKDKLIFIGPDVWTDTNAPDF
IEDDVLFADWKTYTKTTENLKVKVGRWNVPGTPPVILVDFKPFFKEKDSFFFSMWESFRV
DSIHAYGDYDESCIFAYAVGKVIESFYHFYKLENKKVAALFNEWMLGMGALYIKKQLPAV
ATLFTTHATSIGRSIAGNNKALYAYMDGYNGDQMAGELNMEAKHSLEKQTALHVDCFTTV
SDITARECKQLLDKAPDIVTPNGFEPNFVPSDKEYDKKRMAARRDLLNVAEKLLGCPISP
DAFLVSTSGRYEYRNKGIDVFIEAMNRVRTSGRLQREVVAFIMVPAWVRDARADLKEVID
KNIRTTSPMQMPFVTHWLNQMEQDKVLNYISHAGFTNSATDKLKIIFVPCYLDGRDGILN
KPYYDLLIGMDATVYPSYYEPWGYTPLESIAFGIPTITTDLAGFGLWAKKHVTGNNISEG
VAVVNRDDFNYFEVADAITSSILALAGKDKKETAEIRKRSFCLAAKAEWSKFIVYYEEAF
RIALEHASKRNN