Protein Info for HMPREF1078_RS13945 in Parabacteroides merdae CL09T00C40

Annotation: bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/3-hydroxyacyl-ACP dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03331: LpxC
  • amino acids 4 to 297 (294 residues), 282.3 bits, E=4.3e-88
• TIGR01750: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  • amino acids 319 to 456 (138 residues), 166.9 bits, E=2.3e-53
• PF07977: FabA
  • amino acids 328 to 451 (124 residues), 111.3 bits, E=2.9e-36

Best Hits

Swiss-Prot: 74% identical to LPXZ_BACTN: Bifunctional enzyme LpxC/FabZ (lpxC/fabZ) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 93% identity to pdi:BDI_2105)

MetaCyc: 69% identical to bifunctional UDP-3-O-acyl-N-acetylglucosamine deacetylase/3-hydroxyacyl-[acyl-carrier-protein] dehydratase (Porphyromonas gingivalis W50)
3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 4.2.1.59]; RXN-22242 [EC: 4.2.1.59, 3.5.1.108]; 3.5.1.108 [EC: 4.2.1.59, 3.5.1.108]

Predicted SEED Role

"N-acetylglucosamine deacetylase (EC 3.5.1.-) / 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 3.5.1.-, EC 4.2.1.59)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (13/17 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• stearate biosynthesis IV (3/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (13/25 steps found)
• tetradecanoate biosynthesis (mitochondria) (12/25 steps found)
• mycolate biosynthesis (15/205 steps found)
• superpathway of mycolate biosynthesis (16/239 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid biosynthesis
• Glutathione metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Sphingolipid metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-, 4.2.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108 or 4.2.1.- or 4.2.1.59

Protein Sequence (461 amino acids)

>HMPREF1078_RS13945 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/3-hydroxyacyl-ACP dehydratase (Parabacteroides merdae CL09T00C40)
MQKQKTLATSFSMQGKGLHTGLDIQITFHPAPENHGYKIKRVDLEGEPVIDAVAENVAGT
QRGTVLSKNGIQVSTIEHAMAALYAYEIDNCLIEVNAPEFPILDGSSRFFSEEIQKAGVV
EQNAPKDYYIVKHKIEVKDEETGSSLIILPDDKFSVNVLISFNSSVLSNQFATLNDLSEF
PTELAASRTFVFVREVEMLLQNNLIKGGDLDNAIVIYDQKVSQEVLDNLADKLSIPHKDV
QDLGYINNKPLVFDNEPARHKLIDVIGDLALIGKPIRGRVIATRPGHKINNQLARMIRKD
IKQNEVQAPVYDPNSTPVMDINRIRELLPHRYPFLLVDKIIEIGGNYIVGVKNITSNEPF
FTGHFPQEPVMPGVLQVEAMAQTGGLLVLNSVDEPERYSTYFMKIDGVKFRQKVVPGDTL
ILRLELLAPIRRGISTMKGYVFVGDKLVSEAEFMAQIVKNK