Protein Info for HMPREF1078_RS13685 in Parabacteroides merdae CL09T00C40

Annotation: class I SAM-dependent rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF17785: PUA_3" amino acids 6 to 68 (63 residues), 76.9 bits, see alignment E=2.1e-25 PF09157: TruB-C_2" amino acids 29 to 64 (36 residues), 21.8 bits, see alignment 3.6e-08 PF10672: Methyltrans_SAM" amino acids 179 to 343 (165 residues), 82.7 bits, see alignment E=6.9e-27 PF03602: Cons_hypoth95" amino acids 215 to 314 (100 residues), 33.6 bits, see alignment E=7.8e-12

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 94% identity to pdi:BDI_0392)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>HMPREF1078_RS13685 class I SAM-dependent rRNA methyltransferase (Parabacteroides merdae CL09T00C40)
MKECKVFLKPKKEESLLRFHPWVFSGAIQTIEGEPEEGDLVEVYGTNGRFLGIGHYQIGS
IAVRILSFKPVTIDAAFWEERIRIAYTLRQTLELAGVENNNTYRLVHGEGDNLPGLVIDM
YAHTAVMQAHSVGMHYARHQIAEALKAVLGDSLQNIYYKSEATLPYKANLGSEDGYLYGG
EVEDIALENGLKFCVDWQKGQKTGFFVDQRENRSLLERYAKGRSVLNMFCYTGGFSFYAM
RGGAKVVHSVDSSAKAISLTNRNVELNFPGDPRHEAYAEDAFKYLEKMGSNYDLIILDPP
AFAKHKNVLRNALQGYRKLNAIAFEKIKPGGILFTFSCSQVVSKENFRLAVFSAAAQSGR
SVRILHQLTQPADHPVNIYHPEGEYLKGLVLYVE