Protein Info for HMPREF1078_RS13685 in Parabacteroides merdae CL09T00C40

Annotation: class I SAM-dependent rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 6 to 68 (63 residues), 76.9 bits, E=2.1e-25
• PF09157: TruB-C_2
  • amino acids 29 to 64 (36 residues), 21.8 bits, 3.6e-08
• PF10672: Methyltrans_SAM
  • amino acids 179 to 343 (165 residues), 82.7 bits, E=6.9e-27
• PF03602: Cons_hypoth95
  • amino acids 215 to 314 (100 residues), 33.6 bits, E=7.8e-12

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 94% identity to pdi:BDI_0392)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (394 amino acids)

>HMPREF1078_RS13685 class I SAM-dependent rRNA methyltransferase (Parabacteroides merdae CL09T00C40)
MKECKVFLKPKKEESLLRFHPWVFSGAIQTIEGEPEEGDLVEVYGTNGRFLGIGHYQIGS
IAVRILSFKPVTIDAAFWEERIRIAYTLRQTLELAGVENNNTYRLVHGEGDNLPGLVIDM
YAHTAVMQAHSVGMHYARHQIAEALKAVLGDSLQNIYYKSEATLPYKANLGSEDGYLYGG
EVEDIALENGLKFCVDWQKGQKTGFFVDQRENRSLLERYAKGRSVLNMFCYTGGFSFYAM
RGGAKVVHSVDSSAKAISLTNRNVELNFPGDPRHEAYAEDAFKYLEKMGSNYDLIILDPP
AFAKHKNVLRNALQGYRKLNAIAFEKIKPGGILFTFSCSQVVSKENFRLAVFSAAAQSGR
SVRILHQLTQPADHPVNIYHPEGEYLKGLVLYVE