Protein Info for HMPREF1078_RS13645 in Parabacteroides merdae CL09T00C40

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00356: LacI" amino acids 7 to 51 (45 residues), 57.9 bits, see alignment 1e-19 PF13407: Peripla_BP_4" amino acids 67 to 323 (257 residues), 108.9 bits, see alignment E=5.2e-35 PF00532: Peripla_BP_1" amino acids 77 to 266 (190 residues), 29.7 bits, see alignment E=7.1e-11

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 68% identity to pdi:BDI_0378)

Predicted SEED Role

"transcriptional regulator, putative catabolite control protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>HMPREF1078_RS13645 LacI family DNA-binding transcriptional regulator (Parabacteroides merdae CL09T00C40)
MGKTYRIKDIAEMSGVSTGTVDRILHNRGKVSEEAQKKVEKVLKEIDYHPNLIARSLALK
KNYHFITLTPSFTKGEYWDKLCEGIDKAEQELFSYNVEVERMCFNQYDKSSFDELIPRIE
KADCQGVVIATQFHDSVVKLASRLDQLQIPYILIDAFIENTNCVAYYGTNSYDSGYIAGR
LLYEQINPTENIAIFRFIRKGEMQVTQVMKREEGFRNYLAEKNYDGRIYSVQLHADEPEK
NISILNTFLEEHKEVNAGIIFNSRAHLLGKYFRDKGEKFRLIGYDVIDPNITCLNDGSIT
HLIAQRPEVQGFNCIRALFRHLVLKEKVEQINYMPIDILMKENIKYYNNYI